| Edit |   |
| Antigenic Specificity | ARL3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ARL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARL3. This antibody reacts with human. The ARL3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ARL3 (ADP-ribosylation factor-like 3) The peptide sequence was selected from the N terminal of ARL3. Peptide sequence QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP. |
| Other Names | ADP-ribosylation factor-like 3, ARFL3ADP-ribosylation factor-like protein 3, ARF-like 3 |
| Gene, Accession # | ARL3, Gene ID: 403 |
| Catalog # | NBP1-69096 |
| Price | |
| Order / More Info | ARL3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |