| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | c-Myc |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The c-Myc Antibody from Novus Biologicals is a rabbit polyclonal antibody to c-Myc. This antibody reacts with human. The c-Myc Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human c-Myc antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP |
|---|
| Other Names | avian myelocytomatosis viral oncogene homolog, BHLHE39, bHLHe39MRTL, Class E basic helix-loop-helix protein 39, c-Myc, MYC, myc proto-oncogene protein, MYCC, myc-related translation/localization regulatory factor, Proto-oncogene c-Myc, Transcription factor p64, v-myc avian myelocytomatosis viral oncogene homolog, v-myc myelocytomatosis viral oncogene homolog (avian) |
|---|
| Gene, Accession # | MYC, Gene ID: 4609 |
|---|
| Catalog # | NBP2-56660 |
|---|
| Price | |
|---|
| Order / More Info | c-Myc Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|