| Edit |   |
| Antigenic Specificity | HE2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HE2. This antibody reacts with human. The HE2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is HE2 - N-terminal region. Peptide sequence LFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRT. |
| Other Names | EDDM2A, sperm associated antigen 11A |
| Gene, Accession # | SPAG11A, Gene ID: 653423, Accession: NP_001075021, SwissProt: NP_001075021 |
| Catalog # | NBP1-98296 |
| Price | |
| Order / More Info | HE2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |