| Edit |   |
|---|
| Antigenic Specificity | HE2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HE2. This antibody reacts with human. The HE2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is HE2 - N-terminal region. Peptide sequence LFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRT. |
|---|
| Other Names | EDDM2A, sperm associated antigen 11A |
|---|
| Gene, Accession # | SPAG11A, Gene ID: 653423, Accession: NP_001075021, SwissProt: NP_001075021 |
|---|
| Catalog # | NBP1-98296-20ul |
|---|
| Price | |
|---|
| Order / More Info | HE2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|