| 产品详情 |
| Edit |   |
| Antigenic Specificity | GST Epitope Tag |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GST Epitope Tag Antibody from Novus Biologicals is a rabbit polyclonal antibody to GST Epitope Tag. This antibody reacts with human. The GST Epitope Tag Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GST Epitope Tag antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MLGSLVAQLSFPGFPSIQLPYLIDGAHKITQ |
| Other Names | EC 2.5.1.18, glutathione S-alkyltransferase, glutathione S-aralkyltransferase, glutathione S-aryltransferase, glutathione S-transferase M1, glutathione S-transferase mu 1, GST class-mu 1, GST HB subunit 4, GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, HB subunit 4, MGC26563, MU, MU-1, S-(hydroxyalkyl)glutathione lyase |
| Gene, Accession # | GSTM1, Gene ID: 2944 |
| Catalog # | NBP2-14074 |
| Price | |
| Order / More Info | GST Epitope Tag Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|