| Edit |   |
| Antigenic Specificity | GSTA5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GSTA5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GSTA5. This antibody reacts with human. The GSTA5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GSTA5(glutathione S-transferase A5) The peptide sequence was selected from the middle region of GSTA5. Peptide sequence QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE. |
| Other Names | EC 2.5.1.18, glutathione S-transferase A5, Glutathione S-transferase A5-5, glutathione S-transferase alpha 5, glutathione transferase A5, GST class-alpha member 5 |
| Gene, Accession # | GSTA5, Gene ID: 221357, Accession: Q7RTV2, SwissProt: Q7RTV2 |
| Catalog # | NBP1-55181-20ul |
| Price | |
| Order / More Info | GSTA5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |