| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | USP46 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. IP, ChIP, WB reported in scientific literature (PMID: 25855980). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USP46 Antibody from Novus Biologicals is a rabbit polyclonal antibody to USP46. This antibody reacts with human. The USP46 Antibody has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human USP46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN |
|---|
| Other Names | Deubiquitinating enzyme 46, EC 3.1.2.15, EC 3.4.19.12, FLJ11850, FLJ12552, FLJ14283, FLJ39393, ubiquitin carboxyl-terminal hydrolase 46, ubiquitin specific peptidase 46, ubiquitin specific protease 46, ubiquitin thioesterase 46, Ubiquitin thiolesterase 46, Ubiquitin-specific-processing protease 46 |
|---|
| Gene, Accession # | USP46, Gene ID: 64854, Accession: P62068, SwissProt: P62068 |
|---|
| Catalog # | NBP1-82293 |
|---|
| Price | |
|---|
| Order / More Info | USP46 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25855980 |
|---|
| 产品资料 |
|
|