| 产品详情 |
| Edit |   |
| Antigenic Specificity | TMX2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 29507424) and customer review. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMX2. This antibody reacts with human. The TMX2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TMX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSP |
| Other Names | Cell proliferation-inducing gene 26 protein, DKFZp781O2021, growth-inhibiting gene 11, MGC111151, PDIA12, PIG26, protein disulfide isomerase family A, member 12, thioredoxin domain containing 14, Thioredoxin domain-containing protein 14, thioredoxin-related transmembrane protein 2, TXNDC14 |
| Gene, Accession # | TMX2, Gene ID: 51075 |
| Catalog # | NBP1-87305 |
| Price | |
| Order / More Info | TMX2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29507424 |
| 产品资料 |
|
|