| Edit |   |
|---|
| Antigenic Specificity | TMTC4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMTC4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMTC4. This antibody reacts with human. The TMTC4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMTC4(transmembrane and tetratricopeptide repeat containing 4) The peptide sequence was selected from the C terminal of TMTC4. Peptide sequence NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW. |
|---|
| Other Names | FLJ14624, FLJ22153, transmembrane and tetratricopeptide repeat containing 4, transmembrane and TPR repeat-containing protein 4 |
|---|
| Gene, Accession # | TMTC4, Gene ID: 84899, Accession: Q5T4D3, SwissProt: Q5T4D3 |
|---|
| Catalog # | NBP1-59824-20ul |
|---|
| Price | |
|---|
| Order / More Info | TMTC4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|