| Edit |   |
| Antigenic Specificity | TMTC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMTC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMTC2. This antibody reacts with human. The TMTC2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMTC2(transmembrane and tetratricopeptide repeat containing 2) The peptide sequence was selected form the N terminal of TMTC2. Peptide sequence SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK. |
| Other Names | DKFZp762A217, transmembrane and tetratricopeptide repeat containing 2, transmembrane and TPR repeat-containing protein 2 |
| Gene, Accession # | TMTC2, Gene ID: 160335, Accession: Q8N394, SwissProt: Q8N394 |
| Catalog # | NBP1-62592 |
| Price | |
| Order / More Info | TMTC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |