| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TM4SF1/L6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TM4SF1/L6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TM4SF1/L6. This antibody reacts with human. The TM4SF1/L6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TM4SF1/L6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI |
|---|
| Other Names | L6, M3S1Tumor-associated antigen L6, Membrane component chromosome 3 surface marker 1, membrane component, chromosome 3, surface marker 1, TAAL6H-L6, transmembrane 4 L six family member 1, transmembrane 4 L6 family member 1, transmembrane 4 superfamily member 1 |
|---|
| Gene, Accession # | TM4SF1, Gene ID: 4071, Accession: P30408, SwissProt: P30408 |
|---|
| Catalog # | NBP1-82854 |
|---|
| Price | |
|---|
| Order / More Info | TM4SF1/L6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|