| Edit |   |
|---|
| Antigenic Specificity | TM9SF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TM9SF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TM9SF1. This antibody reacts with human. The TM9SF1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TM9SF1(transmembrane 9 superfamily member 1) The peptide sequence was selected from the N terminal of TM9SF1. Peptide sequence YMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLR. |
|---|
| Other Names | HMP70, MP70, MP70 protein family member, multispanning membrane protein (70kD), transmembrane 9 superfamily member 1, transmembrane protein 9 superfamily member 1 |
|---|
| Gene, Accession # | TM9SF1, Gene ID: 10548, Accession: O15321, SwissProt: O15321 |
|---|
| Catalog # | NBP1-62531-20ul |
|---|
| Price | |
|---|
| Order / More Info | TM9SF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|