| Edit |   |
|---|
| Antigenic Specificity | Sertad1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sertad1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sertad1. This antibody reacts with human. The Sertad1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Sertad1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSMYDNELWAPASEGLKPGPEDGPGKEEAPELDEAELDYLMDVLVGTQALERP |
|---|
| Other Names | SEI-1, SEI1CDK4-binding protein p34SEI1, SERTA domain containing 1, SERTA domain-containing protein 1, Transcriptional regulator interacting with the PHD-bromodomain 1, TRIP-Br1CDK4-binding protein p34SEI |
|---|
| Gene, Accession # | SERTAD1, Gene ID: 29950 |
|---|
| Catalog # | NBP2-56527 |
|---|
| Price | |
|---|
| Order / More Info | Sertad1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|