| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RFC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RFC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RFC2. This antibody reacts with human, mouse, rat. The RFC2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat RFC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASND |
|---|
| Other Names | A1, A1 40 kDa subunit, Activator 1 40 kDa subunit, Activator 1 subunit 2, MGC3665, replication factor C (activator 1) 2, 40kDa, replication factor C 2, Replication factor C 40 kDa subunit, replication factor C subunit 2, RF-C 40 kDa subunit, RFC40replication factor C (activator 1) 2 (40kD) |
|---|
| Gene, Accession # | RFC2, Gene ID: 5982 |
|---|
| Catalog # | NBP1-89341 |
|---|
| Price | |
|---|
| Order / More Info | RFC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|