| 产品详情 |
| Edit |   |
| Antigenic Specificity | RFC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RFC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RFC1. This antibody reacts with human. The RFC1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RFC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAI |
| Other Names | A1, A1 140 kDa subunit, Activator 1 140 kDa subunit, Activator 1 large subunit, Activator 1 subunit 1, MGC51786, MHC binding factor, beta, MHCBFB, PO-GA, RECC1, replication factor C (activator 1) 1 (145kD), replication factor C (activator 1) 1, 145kDa, Replication factor C 140 kDa subunit, Replication factor C large subunit, replication factor C subunit 1, replication factor C1, RFC, RF-C 140 kDa subunit, RFC140DNA-binding protein PO-GA |
| Gene, Accession # | RFC1, Gene ID: 5981 |
| Catalog # | NBP2-54960 |
| Price | |
| Order / More Info | RFC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|