| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MDR1/ABCB1 |
|---|
| Clone | 1F11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MDR1/ABCB1 Antibody (1F11) from Novus Biologicals is a mouse monoclonal antibody to MDR1/ABCB1. This antibody reacts with human. The MDR1/ABCB1 Antibody (1F11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ABCB1 (NP_000918, 620 a.a. - 709 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP |
|---|
| Other Names | ABC20, ATP-binding cassette sub-family B member 1, ATP-binding cassette, sub-family B (MDR/TAP), member 1, CD243, CD243 antigen, CLCS, colchicin sensitivity, doxorubicin resistance, EC 3.6.3, EC 3.6.3.44, GP170, IBD13, MDR1MGC163296, multidrug resistance protein 1, P-glycoprotein 1, P-gp, PGY1P-GP |
|---|
| Gene, Accession # | ABCB1, Gene ID: 5243, Accession: NP_000918, SwissProt: NP_000918 |
|---|
| Catalog # | H00005243-M01 |
|---|
| Price | |
|---|
| Order / More Info | MDR1/ABCB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|