| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MED14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MED14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED14. This antibody reacts with human. The MED14 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MED14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP |
|---|
| Other Names | Activator-recruited cofactor 150 kDa component, ARC150, Cofactor required for Sp1 transcriptional activation subunit 2, cofactor required for Sp1 transcriptional activation, subunit 2 (150kD), CRSP150, CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa, CSRP, CXorf4MGC104513, EXLM1CRSP complex subunit 2, human homolog of yeast RGR1, mediator complex subunit 14DRIP150, mediator of RNA polymerase II transcription subunit 14, RGR1RGR1 homolog, Thyroid hormone receptor-associated protein complex 170 kDa component, thyroid hormone receptor-associated protein complex component TRAP170, transcriptional co-activator CRSP150, Transcriptional coactivator CRSP150, Trap170, TRAP170hRGR1, vitamin D receptor-interacting protein complex component DRIP150, Vitamin D3 receptor-interacting protein complex 150 kDa component |
|---|
| Gene, Accession # | MED14, Gene ID: 9282 |
|---|
| Catalog # | NBP2-56318 |
|---|
| Price | |
|---|
| Order / More Info | MED14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|