| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MED13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MED13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED13. This antibody reacts with human. The MED13 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MED13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH |
|---|
| Other Names | Activator-recruited cofactor 250 kDa component, KIAA0593HSPC221, mediator complex subunit 13ARC250, mediator of RNA polymerase II transcription, subunit 13 homolog, THRAP1mediator of RNA polymerase II transcription subunit 13, thyroid hormone receptor associated protein 1, Thyroid hormone receptor-associated protein 1, Thyroid hormone receptor-associated protein complex 240 kDa component, thyroid hormone receptor-associated protein complex component TRAP240, thyroid hormone receptor-associated protein, 240 kDa subunit, Trap240, TRAP240DRIP250, Vitamin D3 receptor-interacting protein complex component DRIP250 |
|---|
| Gene, Accession # | MED13, Gene ID: 9969 |
|---|
| Catalog # | NBP2-57545 |
|---|
| Price | |
|---|
| Order / More Info | MED13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|