| 产品详情 |
| Edit |   |
| Antigenic Specificity | MED10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MED10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED10. This antibody reacts with human. The MED10 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MED10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVP |
| Other Names | L6, mediator complex subunit 10TRG-17, mediator of RNA polymerase II transcription subunit 10, mediator of RNA polymerase II transcription, subunit 10, mediator of RNA polymerase II transcription, subunit 10 homolog (NUT2, S.cerevisiae), MGC5309, NUT2TRG-20, Transformation-related gene 17 protein, Transformation-related gene 20 protein, TRG20 |
| Gene, Accession # | MED10, Gene ID: 84246 |
| Catalog # | NBP2-58707 |
| Price | |
| Order / More Info | MED10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|