| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MED10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MED10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED10. This antibody reacts with human. The MED10 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS |
|---|
| Other Names | L6, mediator complex subunit 10TRG-17, mediator of RNA polymerase II transcription subunit 10, mediator of RNA polymerase II transcription, subunit 10, mediator of RNA polymerase II transcription, subunit 10 homolog (NUT2, S.cerevisiae), MGC5309, NUT2TRG-20, Transformation-related gene 17 protein, Transformation-related gene 20 protein, TRG20 |
|---|
| Gene, Accession # | MED10, Gene ID: 84246 |
|---|
| Catalog # | NBP1-81328 |
|---|
| Price | |
|---|
| Order / More Info | MED10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|