| Edit |   |
|---|
| Antigenic Specificity | DPPA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DPPA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPPA2. This antibody reacts with human. The DPPA2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human DPPA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG |
|---|
| Other Names | CT100, developmental pluripotency associated 2, developmental pluripotency-associated protein 2, PESCRG1cancer/testis antigen 100, Pluripotent embryonic stem cell-related gene 1 protein |
|---|
| Gene, Accession # | DPPA2, Gene ID: 151871 |
|---|
| Catalog # | NBP1-85426 |
|---|
| Price | |
|---|
| Order / More Info | DPPA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|