| Edit |   |
|---|
| Antigenic Specificity | CDR2L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDR2L Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDR2L. This antibody reacts with human. The CDR2L Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human CDR2L. Peptide sequence VQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPE. |
|---|
| Other Names | cerebellar degeneration-related protein 2-like, HUMPPA, paraneoplastic 62 kDa antigen, paraneoplastic antigen |
|---|
| Gene, Accession # | CDR2L, Gene ID: 30850, Accession: NP_055418, SwissProt: NP_055418 |
|---|
| Catalog # | NBP1-91524 |
|---|
| Price | |
|---|
| Order / More Info | CDR2L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|