| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Laminin alpha 2 |
|---|
| Clone | 3450 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Laminin alpha 2 Antibody (3450) from Novus Biologicals is a mouse monoclonal antibody to Laminin alpha 2. This antibody reacts with human, mouse, rat. The Laminin alpha 2 Antibody (3450) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat Laminin alpha 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRIVASRTGRNGT |
|---|
| Other Names | Laminin M chain, laminin subunit alpha-2, laminin, alpha 2, Laminin-12 subunit alpha, Laminin-2 subunit alpha, LAMMLaminin-4 subunit alpha, Merosin heavy chain |
|---|
| Gene, Accession # | LAMA2, Gene ID: 3908, Accession: P24043 |
|---|
| Catalog # | NBP2-46624 |
|---|
| Price | |
|---|
| Order / More Info | Laminin alpha 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|