| Edit |   |
|---|
| Antigenic Specificity | DBF4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DBF4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DBF4. This antibody reacts with mouse. The DBF4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Dbf4 - C-terminal region. Peptide sequence AELDKKRTEYLPAHEDRTCGSPVQSLLDLFQTSEEKSEFLGFTGYTENSG. |
|---|
| Other Names | ASKchif, DBF4 homolog (S. cerevisiae), DBF4ACHIF, DBF4-type zinc finger-containing protein 1, ZDBF1DBF-type containing 1 |
|---|
| Gene, Accession # | DBF4, Gene ID: 10926, Accession: NP_001177646 |
|---|
| Catalog # | NBP1-98390-20ul |
|---|
| Price | |
|---|
| Order / More Info | DBF4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|