| 产品详情 |
| Edit |   |
| Antigenic Specificity | APEG1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 25087613) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The APEG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to APEG1. This antibody reacts with human. The APEG1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human APEG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VYKSVIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTYTVQHQV |
| Other Names | aortic preferentially expressed gene 1, Aortic preferentially expressed protein 1, APEG1, BPEG, EC 2.7.11, EC 2.7.11.1, KIAA1297APEG-1, MGC12676, nuclear protein, marker for differentiated aortic smooth muscle anddown-regulated with vascular injury, SPEG complex locus, SPEGalpha, SPEGbeta, striated muscle preferentially expressed protein kinase |
| Gene, Accession # | SPEG, Gene ID: 10290, Accession: Q15772, SwissProt: Q15772 |
| Catalog # | NBP1-90134 |
| Price | |
| Order / More Info | APEG1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25087613 |
| 产品资料 |
|
|