| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AP3D1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AP3D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP3D1. This antibody reacts with human. The AP3D1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human AP3D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAG |
|---|
| Other Names | Adapter-related protein complex 3 subunit delta-1, adaptin, delta, adaptor-related protein complex 3, delta 1 subunit, ADTD, AP-3 complex delta subunit, partial CDS, AP-3 complex subunit delta, AP-3 complex subunit delta-1, delta adaptin, Delta-adaptin, delta-adaptin, partial CDS, hBLVR, subunit of putative vesicle coat adaptor complex AP-3 |
|---|
| Gene, Accession # | AP3D1, Gene ID: 8943 |
|---|
| Catalog # | NBP2-57286 |
|---|
| Price | |
|---|
| Order / More Info | AP3D1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|