| 产品详情 |
| Edit |   |
| Antigenic Specificity | Blood group H inhibitor |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Blood group H inhibitor Antibody from Novus Biologicals is a rabbit polyclonal antibody to Blood group H inhibitor. This antibody reacts with human. The Blood group H inhibitor Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to FUT1 (fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)) The peptide sequence was selected from the middle region of FUT1 (NP_000139). Peptide sequence EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGG |
| Other Names | alpha (1,2) fucosyltransferase, Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase, Blood group H alpha 2-fucosyltransferase, EC 2.4.1.69, Fucosyltransferase 1, fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group), galactoside 2-alpha-L-fucosyltransferase 1, GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1, HHH, HSC |
| Gene, Accession # | FUT1, Gene ID: 2523, Accession: P19526, SwissProt: P19526 |
| Catalog # | NBP1-57016-20ul |
| Price | |
| Order / More Info | Blood group H inhibitor Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|