| 产品详情 |
| Edit |   |
| Antigenic Specificity | Blood Group B Transferase/GTB/ABO |
| Clone | 1B7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Blood Group B Transferase/GTB/ABO Antibody (1B7) from Novus Biologicals is a mouse monoclonal antibody to Blood Group B Transferase/GTB/ABO. This antibody reacts with human. The Blood Group B Transferase/GTB/ABO Antibody (1B7) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | ABO (NP_065202.2, 273 a.a. - 354 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP |
| Other Names | A transferase, A3GALNT, A3GALT1, ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase;transferase B, alpha 1-3-galactosyltransferase), ABO glycosyltransferase, B transferase, B(A) alpha-1,3-galactosyltransferase, EC 2.4.1.37, EC 2.4.1.40, Fucosylglycoprotein 3-alpha-galactosyltransferase, Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase, Glycoprotein-fucosylgalactoside alpha-galactosyltransferase, Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase, GTB, Histo-blood group A transferase, histo-blood group A2 transferase, histo-blood group ABO system transferase, Histo-blood group B transferase, NAGAT |
| Gene, Accession # | ABO, Gene ID: 28, Accession: NP_065202.2, SwissProt: NP_065202.2 |
| Catalog # | H00000028-M08 |
| Price | |
| Order / More Info | Blood Group B Transferase/GTB/ABO Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|