| Edit |   |
| Antigenic Specificity | Apc7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Apc7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Apc7. This antibody reacts with human. The Apc7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: 7 |
| Immunogen | Synthetic peptides corresponding to ANAPC7(anaphase promoting complex subunit 7) The peptide sequence was selected from the C terminal of ANAPC7 (NP_057322). Peptide sequence ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS. |
| Other Names | anaphase promoting complex subunit 7, anaphase-promoting complex subunit 7, APC7Cyclosome subunit 7 |
| Gene, Accession # | ANAPC7, Gene ID: 51434, Accession: Q9UJX3, SwissProt: Q9UJX3 |
| Catalog # | NBP1-58224 |
| Price | |
| Order / More Info | Apc7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |