| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GSPT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GSPT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GSPT2. This antibody reacts with human. The GSPT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GSPT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT |
|---|
| Other Names | eRF3b, ERF3BGST2, eukaryotic peptide chain release factor GTP-binding subunit ERF3B, Eukaryotic peptide chain release factor subunit 3b, FLJ10441, G1 to S phase transition 2, G1 to S phase transition protein 2 homolog |
|---|
| Gene, Accession # | GSPT2, Gene ID: 23708 |
|---|
| Catalog # | NBP1-91971 |
|---|
| Price | |
|---|
| Order / More Info | GSPT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|