| Edit |   |
|---|
| Antigenic Specificity | Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TNFRSF21 is a member of the TNF-receptor superfamily. This receptor has been shown to activateNF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction ofTNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. |
|---|
| Immunogen | TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV |
|---|
| Other Names | TNFRSF21|tnfrsf21|MGC146356|BM-018|CD358|DR6|AA959878|R74815|TR7|dr6|im:6795346|wu:fa55e01|wu:fb02e11|wu:fc29a09|wu:fi27h08 |
|---|
| Gene, Accession # | Gene ID: 27242 |
|---|
| Catalog # | ABIN636122 |
|---|
| Price | |
|---|
| Order / More Info | Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|