| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tmp21/p23 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tmp21/p23 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tmp21/p23. This antibody reacts with human. The Tmp21/p23 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Tmp21/p23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTN |
|---|
| Other Names | 21 kDa transmembrane-trafficking protein, p23, P24(DELTA), p24delta, S31I125, S31III125, TMP21Tmp-21-I, transmembrane emp24 domain-containing protein 10, transmembrane emp24-like trafficking protein 10 (yeast), Transmembrane protein Tmp21,21 kDa transmembrane trafficking protein |
|---|
| Gene, Accession # | TMED10, Gene ID: 10972 |
|---|
| Catalog # | NBP2-47600 |
|---|
| Price | |
|---|
| Order / More Info | Tmp21/p23 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|