| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMLHE |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMLHE Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMLHE. This antibody reacts with human. The TMLHE Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TMLHE antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWVKLKPGRVLFIDNWRVLHGRECFTGYRQLCGCYLTRDDVLNTAR |
|---|
| Other Names | BBOX2TML-alpha-ketoglutarate dioxygenase, butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetainehydroxylase) 2, EC 1.14.11.8, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, Epsilon-trimethyllysine hydroxylase, FLJ10727, TML dioxygenase, TMLD, TMLHTML hydroxylase, trimethyllysine dioxygenase, mitochondrial, trimethyllysine hydroxylase, epsilon, XAP130 |
|---|
| Gene, Accession # | TMLHE, Gene ID: 55217 |
|---|
| Catalog # | NBP2-55562 |
|---|
| Price | |
|---|
| Order / More Info | TMLHE Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|