| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Hydroxyacid Oxidase-1/HAO-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hydroxyacid Oxidase-1/HAO-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hydroxyacid Oxidase-1/HAO-1. This antibody reacts with human. The Hydroxyacid Oxidase-1/HAO-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Hydroxyacid Oxidase-1/HAO-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDL STSVLGQRVSMPICVGATAMQRMAHVDGELATVR |
|---|
| Other Names | (S)-2-hydroxy-acid oxidase, EC 1.1.3.15, Glycolate oxidase, GOX1MGC142227, GOXMGC142225, HAOX1, hydroxyacid oxidase (glycolate oxidase) 1, hydroxyacid oxidase 1 |
|---|
| Gene, Accession # | HAO1, Gene ID: 54363 |
|---|
| Catalog # | NBP2-14080 |
|---|
| Price | |
|---|
| Order / More Info | Hydroxyacid Oxidase-1/HAO-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24648543 |
|---|
| 产品资料 |
|
|