| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VRL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VRL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VRL1. This antibody reacts with human. The VRL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human VRL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS |
|---|
| Other Names | Osm-9-like TRP channel 2, transient receptor potential cation channel, subfamily V, member 2, TrpV2, Vanilloid receptor-like protein 1, VRL-1MGC12549, VRL1transient receptor potential cation channel subfamily V member 2, VRLOTRPC2 |
|---|
| Gene, Accession # | TRPV2, Gene ID: 51393 |
|---|
| Catalog # | NBP1-92576 |
|---|
| Price | |
|---|
| Order / More Info | VRL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|