| 产品详情 |
| Edit |   |
| Antigenic Specificity | VRK3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VRK3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VRK3. This antibody reacts with human. The VRK3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human VRK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS |
| Other Names | inactive serine/threonine-protein kinase VRK3, serine/threonine-protein kinase VRK3, Serine/threonine-protein pseudokinase VRK3, vaccinia related kinase 3, Vaccinia-related kinase 3 |
| Gene, Accession # | VRK3, Gene ID: 51231 |
| Catalog # | NBP2-58572 |
| Price | |
| Order / More Info | VRK3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|