| Edit |   |
| Antigenic Specificity | VPS13D |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VPS13D Antibody from Novus Biologicals is a rabbit polyclonal antibody to VPS13D. This antibody reacts with human. The VPS13D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VPS13D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPP PFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM |
| Other Names | VPS13D vacuolar protein sorting 13 homolog D (S. cerevisiae) |
| Gene, Accession # | VPS13D, Gene ID: 55187 |
| Catalog # | NBP2-14742 |
| Price | |
| Order / More Info | VPS13D Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |