| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Connexin 43/GJA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Connexin 43/GJA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Connexin 43/GJA1. This antibody reacts with human. The Connexin 43/GJA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Connexin 43/GJA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR |
|---|
| Other Names | connexin 43, connexin-43, Cx43, CX43gap junction protein, alpha-like, DFNB38, Gap junction 43 kDa heart protein, gap junction alpha-1 protein, gap junction protein, alpha 1, 43kDa, gap junction protein, alpha 1, 43kDa (connexin 43), GJAL, HSS, ODD, ODDD, ODOD, SDTY3 |
|---|
| Gene, Accession # | GJA1, Gene ID: 2697, Accession: P17302, SwissProt: P17302 |
|---|
| Catalog # | NBP2-38234 |
|---|
| Price | |
|---|
| Order / More Info | Connexin 43/GJA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|