| Edit |   |
|---|
| Antigenic Specificity | SLC5A5/Sodium Iodide Symporter |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC5A5/Sodium Iodide Symporter Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC5A5/Sodium Iodide Symporter. This antibody reacts with human. The SLC5A5/Sodium Iodide Symporter Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC5A5 (solute carrier family 5 (sodium iodide symporter), member 5) The peptide sequence was selected from the N terminal of SLC5A5)(50ug). Peptide sequence TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQ |
|---|
| Other Names | Na(+)/I(-) cotransporter, Na(+)/I(-) symporter, NISNa(+)/I(-)-symporter, sodium/iodide cotransporter, Sodium-iodide symporter, solute carrier family 5 (sodium iodide symporter), member 5, Solute carrier family 5 member 5, TDH1 |
|---|
| Gene, Accession # | SLC5A5, Gene ID: 6528, Accession: Q92911, SwissProt: Q92911 |
|---|
| Catalog # | NBP1-59851-20ul |
|---|
| Price | |
|---|
| Order / More Info | SLC5A5/Sodium Iodide Symporter Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|