| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC5A5/Sodium Iodide Symporter |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC-P reported in a customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC5A5/Sodium Iodide Symporter Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC5A5/Sodium Iodide Symporter. This antibody reacts with human, rat. The SLC5A5/Sodium Iodide Symporter Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC5A5/Sodium Iodide Symporter antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL |
|---|
| Other Names | Na(+)/I(-) cotransporter, Na(+)/I(-) symporter, NISNa(+)/I(-)-symporter, sodium/iodide cotransporter, Sodium-iodide symporter, solute carrier family 5 (sodium iodide symporter), member 5, Solute carrier family 5 member 5, TDH1 |
|---|
| Gene, Accession # | SLC5A5, Gene ID: 6528, Accession: Q92911, SwissProt: Q92911 |
|---|
| Catalog # | NBP2-33547 |
|---|
| Price | |
|---|
| Order / More Info | SLC5A5/Sodium Iodide Symporter Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|