| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC2A4RG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC2A4RG Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC2A4RG. This antibody reacts with human. The SLC2A4RG Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SLC2A4RG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKP |
|---|
| Other Names | GEFHDBP-1, HDBP1GLUT4 enhancer factor, Huntington disease gene regulatory region-binding protein 1, Huntington's disease gene regulatory region-binding protein 1, Si-1-2, Si-1-2-19, SLC2A4 regulator |
|---|
| Gene, Accession # | SLC2A4RG, Gene ID: 56731 |
|---|
| Catalog # | NBP2-57221 |
|---|
| Price | |
|---|
| Order / More Info | SLC2A4RG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|