| Edit |   |
| Antigenic Specificity | Fbxl8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Fbxl8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fbxl8. This antibody reacts with human. The Fbxl8 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Fbxl8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVL |
| Other Names | Fbl8, F-box and leucine-rich repeat protein 8FLJ11278, F-box protein FBL8, F-box/LRR-repeat protein 8, MGC19959 |
| Gene, Accession # | FBXL8, Gene ID: 55336, Accession: Q96CD0, SwissProt: Q96CD0 |
| Catalog # | NBP2-34012 |
| Price | |
| Order / More Info | Fbxl8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |