| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Pax3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Pax3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pax3. This antibody reacts with human. The Pax3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Pax3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPS |
|---|
| Other Names | CDHS, HuP2, HUP2MGC120384, MGC120381, MGC120382, MGC120383, MGC134778, paired box 3, paired box gene 3 (Waardenburg syndrome 1), paired box homeotic gene 3, paired box protein Pax-3, paired domain gene 3, paired domain gene HuP2, Waardenburg syndrome 1, WS1, WS3 |
|---|
| Gene, Accession # | PAX3, Gene ID: 5077 |
|---|
| Catalog # | NBP2-56596 |
|---|
| Price | |
|---|
| Order / More Info | Pax3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|