| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAUF/ZG16B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAUF/ZG16B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAUF/ZG16B. This antibody reacts with human. The PAUF/ZG16B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PAUF/ZG16B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AGKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQA |
|---|
| Other Names | DKFZp762P2216, EC 3.1.2, EC 3.4.19.12, hTrabid, TRABIDubiquitin thioesterase ZRANB1, TRAF-binding protein domain, Zinc finger Ran-binding domain-containing protein 1, zinc finger, RAN-binding domain containing 1 |
|---|
| Gene, Accession # | ZG16B, Gene ID: 124220 |
|---|
| Catalog # | NBP1-81699 |
|---|
| Price | |
|---|
| Order / More Info | PAUF/ZG16B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|