| Edit |   |
| Antigenic Specificity | Chordin-like 2/CHRDL2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Chordin-like 2/CHRDL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Chordin-like 2/CHRDL2. This antibody reacts with human. The Chordin-like 2/CHRDL2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Chordin-like 2/CHRDL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RVLVHTSVSPSPDNLRRFALEHEASDLVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTLELKVTASPDKVTKT |
| Other Names | chordin-like 2, chordin-like protein 2 |
| Gene, Accession # | CHRDL2, Gene ID: 25884 |
| Catalog # | NBP1-88560 |
| Price | |
| Order / More Info | Chordin-like 2/CHRDL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |