| Edit |   |
| Antigenic Specificity | BTG4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BTG4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BTG4. This antibody reacts with human. The BTG4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to BTG4(B-cell translocation gene 4) The peptide sequence was selected from the middle region of BTG4. Peptide sequence ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR. |
| Other Names | B-cell translocation gene 4, BTG family member 4, MGC33003, PC3BProtein PC3b, protein BTG4 |
| Gene, Accession # | BTG4, Gene ID: 54766, Accession: Q9NY30, SwissProt: Q9NY30 |
| Catalog # | NBP1-58173-20ul |
| Price | |
| Order / More Info | BTG4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |