| Edit |   |
| Antigenic Specificity | Chondroadherin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Chondroadherin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Chondroadherin. This antibody reacts with human. The Chondroadherin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CHAD(chondroadherin) The peptide sequence was selected from the middle region of Chondroadherin. Peptide sequence VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL. |
| Other Names | chondroadherin, chondroadherin proteoglycan, SLRR4ACartilage leucine-rich protein |
| Gene, Accession # | CHAD, Gene ID: 1101, Accession: O15335, SwissProt: O15335 |
| Catalog # | NBP1-58039 |
| Price | |
| Order / More Info | Chondroadherin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |