| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Choline Acetyltransferase/ChAT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Choline Acetyltransferase/ChAT Antibody from Novus Biologicals is a rabbit polyclonal antibody to Choline Acetyltransferase/ChAT. This antibody reacts with human, mouse. The Choline Acetyltransferase/ChAT Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse Choline Acetyltransferase/ChAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN |
|---|
| Other Names | acetyl CoA:choline O-acetyltransferase, ChAT, CHOACTase, Choline acetylase, choline acetyltransferase, choline O-acetyltransferase, CMS1A, CMS1A2, EC 2.3.1, EC 2.3.1.6 |
|---|
| Gene, Accession # | CHAT, Gene ID: 1103, Accession: P28329, SwissProt: P28329 |
|---|
| Catalog # | NBP2-33530 |
|---|
| Price | |
|---|
| Order / More Info | Choline Acetyltransferase/ChAT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|