| 产品详情 |
| Edit |   |
| Antigenic Specificity | UBE2M/Ubc12 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UBE2M/Ubc12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBE2M/Ubc12. This antibody reacts with human. The UBE2M/Ubc12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBE2M/Ubc12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQ |
| Other Names | EC 6.3.2, EC 6.3.2.-, hUbc12, NEDD8 carrier protein, NEDD8 protein ligase, UBC12NEDD8-conjugating enzyme Ubc12, UBC-RS2, ubiquitin carrier protein M, Ubiquitin-conjugating enzyme E2 M, ubiquitin-conjugating enzyme E2M (homologous to yeast UBC12), ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast), ubiquitin-protein ligase M, yeast UBC12 homolog |
| Gene, Accession # | UBE2M, Gene ID: 9040 |
| Catalog # | NBP2-49268 |
| Price | |
| Order / More Info | UBE2M/Ubc12 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|