| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBE2J1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBE2J1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBE2J1. This antibody reacts with human. The UBE2J1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to UBE2J1(ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2J1. Peptide sequence METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD. |
|---|
| Other Names | CGI-76, EC 6.3.2.19, HSPC153, HSPC205, HSU93243, HsUBC6e, MGC12555, NCUBE-1, NCUBE1HSUBC6e, Non-canonical ubiquitin-conjugating enzyme 1, non-canonical ubquitin conjugating enzyme 1, Ubc6p, ubiquitin-conjugating enzyme E2 J1, ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast), Yeast ubiquitin-conjugating enzyme UBC6 homolog E |
|---|
| Gene, Accession # | UBE2J1, Gene ID: 51465, Accession: Q9Y385, SwissProt: Q9Y385 |
|---|
| Catalog # | NBP1-59757 |
|---|
| Price | |
|---|
| Order / More Info | UBE2J1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|